PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 835aa    MW: 92337.1 Da    PI: 5.8195
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142947.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.5e-29537587252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+++l++l+++Fs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  XP_009142947.1 537 EKNVTLSVLQQHFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 587
                     89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.881526607IPR003035RWP-RK domain
PfamPF020424.2E-28539587IPR003035RWP-RK domain
SuperFamilySSF542775.56E-22729820No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-23733814No hitNo description
SMARTSM006662.5E-23735817IPR000270PB1 domain
PROSITE profilePS5174520.899735817IPR000270PB1 domain
PfamPF005642.5E-17736816IPR000270PB1 domain
CDDcd064071.18E-36736816No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MILLSIIDEM EHPFASRDKG FGYQDIPTEQ QMDVLSFGSA DMLNSSELMN FDSFSTWFNT  60
PSPTDLLFSQ YGLSTFGATT SSHPPEPRAG LTRSFHDLER SSVQQMSSQF HCSLDINELS  120
GKRRRVVNQT IPRSLSHSLD EKMLKALSLF IESSSGLGEG ILAQIWTPIK AGDQFILSTC  180
DQAYLLDPRL SNYREVSRKF TFASKPNQCS SSPGLPGRVF ISGVREWTSN VRYYKRDEYL  240
RMKHAVDNEV RGSIAIPILE EASGTSCCAV MELVTSKEKH DFDVEMESVC RALQAVNLRT  300
SEIPRPQYLS SNQREALAEI KDVLRAVCHA HKLPLALAWL PCSNGPNSLV LCVEETACYV  360
NDMEMEGFVQ ACLEHCLREK EGIVGKAFVS NQPSFASDVK VYDIGEYPLV HHARKYGLNA  420
AVAIKLRSTY TGEDDYILEL FLPISMKGSL EQQLLLDSLS GTLQRICRTL RTVSDVGATK  480
RSGEISTCSR NLQTIVLDCE LNANSSDKDN SSTGSQATFE QDMSKARTPE KKKSTTEKNV  540
TLSVLQQHFS GSLKDAAKSL GVCPTTLKRI CRQHGIMRWP SRKINKVNRS LRKIQTVLDS  600
VQGVEGGLRF DSARGEFVAA GPTPKGPSSN GNNACEDTSF ELLKAKSVDN AVKLEDDIIT  660
NDSFMDASGQ QWDWMAEQSG FNGKLSSPVT DGMETTIRSM SDSSNSSGAV VLGSSSTSMD  720
DRNQTRTQGE SGSTTLTVKA TYREDTIRFK FESSAGCSQL YKEVSKRFKL QEGSFQLKYL  780
DDEEEWVLMV TDADLQECLE ILYGMGKHTV KFLVRDLPAP IGSSGGSNGY LGTCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121125KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2206745e-81AK220674.1 Arabidopsis thaliana mRNA for putative protein, complete cds, clone: RAFL21-80-B11.
GenBankBT0104595e-81BT010459.1 Arabidopsis thaliana RWP-RK domain containing protein (At3g59580) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142947.10.0PREDICTED: protein NLP8-like isoform X2
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLM4CKN20.0M4CKN2_BRARP; Uncharacterized protein
STRINGBra004767.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein